PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn217431
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 354aa    MW: 38795.3 Da    PI: 10.2143
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn217431genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.5e-14143187347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
       Achn217431 143 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 187
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.997136192IPR017930Myb domain
SuperFamilySSF466895.83E-17138193IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-17139190IPR006447Myb domain, plants
SMARTSM007171.8E-10140190IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-11142187IPR009057Homeodomain-like
CDDcd001672.48E-9143188No hitNo description
PfamPF002492.2E-11143187IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MEPNIGRPRA GELKTIPGKS PMCKSFVLVV QVMVVKGSPC PRTASRFSRR LNRSAMTLPS  60
SCSESGADSG NSVDGGEIML FGVRVKVDPM RKSVSMNNLS QYEQPQQEAS NVAADAAAVG  120
YVSADEAVHH QSAANRERKR GVPWTEEEHK LFLLGLQKVG KGDWRGISRN FVKTRTPTQV  180
ASHAQKYFLR RSNVNRRRRR SSLFDITTES VTAIPMEEEK VHQESKTQPL IPQTLLPPLE  240
TTNINGSLVL PFPVTISPVL VPAQIENPME KLTLGQVDHA NCESAKLIRP IPVLPTLNGT  300
TMVDQSLNQK STVDPSPLSL RLSLSSDHNQ VSRYSAFQVM SSFNNGDKII SVA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00631PBMTransfer from PK23829.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012080161.11e-105PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B07e-92MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLF8SPH01e-109F8SPH0_CAMSI; MYB transcription factor 1
STRINGSolyc06g071230.2.16e-92(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25742351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.21e-48MYB_related family protein